Access unlimited lookups, API and downloads, data enrichment, and Probenet Live.
Get started for freeSummary
Location The geographic location associated with this IP address, including city, region, and country. | Piscataway, New Jersey, US |
ASN An autonomous system is a collection of connected Internet Protocol routing prefixes under the control of one or more network operators on behalf of a single administrative entity or domain, that presents a common and clearly defined routing policy to the Internet. | AS20473 — The Constant Company, LLC |
Hostname On the Internet, a hostname is a domain name assigned to a host computer. This is usually a combination of the host's local name with its parent domain's name. | primarycarepharmacyservices-westmifflin.talkrxsky.com |
Range IP block that the IP address is part of. | 45.76.0.0/20 |
Company Company behind the IP traffic. | Vultr Holdings, LLC |
Hosted domains Number of domains hosted on this IP address | 0 |
Privacy Whether the IP is using a VPN or another method to hide it. | True |
Anycast Anycast addresses are addresses that are shared by multiple systems. | False |
AS Type ISP, business or hosting. | hosting |
Abuse contact Information belonging to the abuse contact. |
IP Geolocation
| Field | Value |
|---|---|
| City | Piscataway |
| State | New Jersey |
| Country | United States |
| Postal | 08854 |
| Local time | 03:17 AM, Monday, June 29, 2026 |
| Timezone | America/New_York |
| Coordinates | 40.4993 N, 74.3990 W |
Anonymization
- Detected
- DetectedHosting
- Proxy
- Tor
- Relay
- Residential Proxy
Powered by Privacy Detection and Residential Proxy data
ASN
AS20473 — The Constant Company, LLC
- Domainconstant.com
- ASN TypeHosting
- Route45.76.0.0/20
Company
Vultr Holdings, LLC
Abuse
NameVultr Abuse
Network45.76.4.0/23